Description
Overview
LL-37, also known as CAP-18, is a cationic antimicrobial peptide. It is a component of the innate immune system and has been studied in various research areas.
Key details
- Name: LL-37 5mg (CAP-18)
- Amount: 5mg
- Form: Lyophilized powder
- Purity: >95% by HPLC
- Sequence: [LL-37, 37 aa]
- Molecular Weight: 4.49 kDa
What you receive
- One vial containing 5mg of LL-37 (CAP-18) peptide
- Certificate of Analysis (CoA)
Quality & testing
Each batch is tested for purity by HPLC and mass spectrometry. Documentation is provided with each product.
Storage & handling
This product ships at ambient temperature. Upon receipt, store the lyophilized peptide in a cool, dark, and dry place. Keep the vial tightly sealed and protect from moisture. Follow standard laboratory safety procedures when handling.
Shipping & returns
We ship worldwide. If you are not satisfied with your purchase, please contact us within 30 days for a full refund.
FAQ
Q: What is the purity of this peptide?
A: Purity is >95% as determined by HPLC.
Q: How should I store the peptide?
A: Store the lyophilized peptide in a cool, dark, and dry place.
Compliance
For research use only. Not for human consumption.
Reviews
There are no reviews yet.